Gold Member Since 2016
Wuhan Chuangshu E-Commerce Co., Ltd.

Lyophilized Peptides Cjc-1295 Without Dac, Cjc-1295 Without Dac for Muscle Building, Cjc-1295 Without Dac for Bodybuilding manufacturer / supplier in China, offering High Purity Peptides Cjc-1295 Without Dac for Muscle Enhance, Top Quality 98% Exemestane Acatate 107868-30-4, Anti-Estrogen Steroids Fulve Strant Acetate (Faslodex) 129453-61-8 and so on.

(/ )

Supplier Homepage Product Peptides High Purity Peptides Cjc-1295 Without Dac for Muscle Enhance

High Purity Peptides Cjc-1295 Without Dac for Muscle Enhance

FOB Price: US $0.75-1 / vial
Min. Order: 10 vial
Min. Order FOB Price
10 vial US $0.75-1/ vial
Get Latest Price
Port: Hong Kong, Hong Kong
Production Capacity: 5000kg/Month
Payment Terms: T/T, Western Union, Money Gram, Bitcoin

Request a custom order and have something just for you!

Send Customized Request
Basic Info
  • Model NO.: CJC-1295 without DAC
  • Customized: Customized
  • Suitable for: Elderly, Adult
  • Purity: >99%
  • Shipping Ways: : UPS, TNT, EMS, DHL, FedEx, etc(Door-to-Door)
  • Delivery Time: 4-7 Working Days
  • Appearance: White Lyophilized Powder
  • Transport Package: as Your Request
  • Origin: China
  • Powder: Yes
  • Certification: ISO 9001, USP, BP
  • State: Solid
  • Assay: 99% Min.
  • Payment Ways: T/T, Western Union, Money Gram, Bitcoin
  • Shipping Time: Within 24 Hours After Payment
  • Trademark: Chuangshu
  • Specification: Qualified
  • HS Code: 4400341001
Product Description
Quick detail:
Cas No.863288-34-0
Chemical NameCJC-1295 without DAC
FormulaC152H252N44O42
One Letter SequenceY(d-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2
Three Letter SequenceH-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
Molecular Weight (MW)3367.97
Solubilityaqueous soluble
StorageStore at -20°C. Product is guaranteed 2 years from the date of shipment. Following reconstitution, store at -20°C. We recommend to add a carrier protein (0.1% HSA or BSA) for long term storage.


Description:
CJC-1295 without DAC is a synthetically modified form of growth hormone releasing hormone (GHRH) [1].
GHRH is used for the treatment of impaired growth in patients with intact pituitary function. The most limitation of its use is the short half-life of it. CJC-1295 was developed for solving this problem. It contains the therapeutic moiety of GHRH (GHRH-(1-29)NH2) with four amino acid substitutions. The change of structure made it more resistant to proteolytic cleavage than GHRH. A drug affinity complex (DAC) linked to the core therapeutic moiety allowed CJC-1295 to bind to endogenous albumin, thus extending its half-life and duration of action. The half-life of CJC-1295 is about 6 to 8 days after sc administration. It was reported that administration of CJC-1295 caused sustained elevations of mean serum GH and IGF-I levels. CJC-1295 also had stimulatory effects on somatotroph cell proliferation. Once-daily injections of CJC-1295 at dose of 2 μg were able to completely normalize growth 

FAQ:

Q1: Are you a manufacture?
A: We manufacture bulk products in our factory.We have lab, pilot workshop.

Q2: What certificates and documents do you offer?
A: Some technical paperwork is available, such as COA, HNMR, HPLC, LC-MS ect.

Q3 :Can I get a sample?
A: Of course. For most products we can provide you a free sample, while the shipping cost should undertake by your side.

Q4: Is there any discount?
A: Yes, for larger quantity, we always support with better price.

Q5: What is MOQ?
A: For steroid powder, the MOQ is 10grams.
   For semi-finished liquid, the MOQ is 50ml.

Q6: How long does it take to the goods arrived ?
A: It is Depending on your location,
For small order, please expect 5-7 days by DHL,UPS,TNT, FEDEX, EMS.
For mass order, please allow 5-8 days by Air, 20-35 days by Sea.

Q7: Do  you  have  any  reshipment  policy ?  
A: we have good after-sale service and re-shipment policy if the parcel  lose.

Q8: What payments do you support?
A: T/T, West union, Moneygram, Bitcoin

Q9: Why should I choose you?
A: Powerful technical support; Strict quality control; Professional and warm sales team; Excellent pre-sale and after-sale service.
Anything wrong happening in our products will be solved within 2 hours. We always offer relative technical support/consultant. Quick response. All your inquiry will be replied within 24 hours.


More products:
 Product NameCAS NO.
 TEST SERIES
1Test EnanthateCAS: 315-37-7
2Test Base  CAS: 58-22-0
3Test AcetateCAS: 1045-69-8
4Test Propionate CAS: 57-85-2
5TestCypionateCAS: 58-20-8
61-Test CypCAS: 65-06-5
7Test PhenylpropionateCAS: 1255-49-8
8Test Isocaproate CAS: 15262-86-9
9Test decanoate CAS: 5721-91-5
10Test Sustanon 250/100/
11Test UndecanoateCAS: 5949-44-0
1217-Alpha-Methyl-TestCAS: 65-04-3
1317-Methyltest-osteroneCAS: 58-18-4
1417-methylandrosta-4CAS: 1039-17-4
15Turinabol CAS: 855-19-6
16Oral Turinabol CAS: 2446-23-3
17Mesta-noloneCAS: 521-11-9
18Stan-oloneCAS: 521-18-6
19Mester-oloneCAS: 1424-00-6
20HexadroneCAS: 63321-10-8
21HalotestinCAS: 76-43-7
 NANDRO SERIES
22NandroCAS: 434-22-0
23Nandro Decanoate (DECA)CAS: 360-70-3
24Nandro Cypionate CAS: 601-63-8
25Nandro UndecanoateCAS: 862-89-5
26Nandro PhenylpropionateCAS: 62-90-8
 TREN SERIES
27Tren Acetate CAS: 10161-34-9
28Tren EnanthateCAS: 10161-33-8
29MetribolCAS: 965-93-5
30Tren Hexahydro CarbonateCAS: 23454-33-3
31Trestolone AcetateCAS: 436144-67-1
32Mibo-leroneCAS: 3704-09-4
33Tibo-lone CAS: 5630-53-5
 BOLDEN SERIES
   
35Bolden PropionateCAS: 63321-10-8
36Bolden AcetateCAS: 10161-34-9
37Bolden CypionateCAS: 106505-90-2
38Bolden UndecylenateCAS: 13103-34-9
39DROSTAN SERIES 
40Drostan PropionateCAS: 521-12-0 
41Drostan Enanthate CAS: 472-61-145
42Superdrol PowderCAS: 3381-88-2
 DH EA SERIES
43Epiandrosterone CAS: 481-29-8
44/CAS: 53-43-0
45/CAS: 853-23-6
467-keto DH EA CAS: 566-19-8
 METHENOLONE SERIES 
47Methenolone Enanthate CAS: 303-42-4 
48Methenolone Acetate CAS: 434-05-9
 ORAL STEROIDS
49AnadrolCAS: 434-07-1
50AnavarCAS: 53-39-4
51WinstrolCAS: 10418-03-8
52Mesterolon CAS: 72-63-9   
 ANTI-ESTROGEN 
53Androsterone CAS: 53-41-8
54Tamoxifen Citrate (Nolvadex) CAS: 54965-24-1
55Clomiphene citrate (clomid)CAS: 50-41-9
56Toremifene citrate CAS: 89778-27-8
57AromasinCAS: 107868-30-4
58ArimidexCAS: 120511-73-1
59FemaraCAS: 112809-51-5
 EPINEPHRINE & THYROXINE 
60T3 CAS: 6893-2-3
61T4 / L-ThyroxineCAS: 25416-65-3
62L-Epinephrine HCl CAS: 55-31-2
63L-Noradrenaline Bitartrate CAS: 108341-18-0
64L(-)-EpinephrineCAS: 51-43-4
65Phenylephrine hydrochlorideCAS: 61-76-7
66Epinephrine bitartrateCAS: 51-42-3
67STEROID INTERMEDIATE  
681,4-Andro-stadiene-dione CAS: 897-06-3
69Andro-stene-dione CAS: 63-05-8
70Methoxydienone CAS: 2322-77-2
 MALE ENHANCEMETN 
71TadalafilCAS: 171596-29-5
72Sil-dena-fil Citrate   /
73Sil-dena-fil Mesylate /
74Sil-dena-fil /
75vardenafil CAS: 224789-15-5
76Avanafil CAS: 330784-47-9
77Acetildenafil (Hongdenafil) CAS: 831217-01-7
78Dapoxetine CAS: 119356-77-3
79Dapoxetine hydrochlorideCAS: 129938-20-1
80Dapoxetine HCl CAS: 119356-77-3
81Dutasteride CAS: 164656-23-9
82Finasteride (Proscar)CAS: 98319-26-7
83Yohimbine HCl CAS: 65-19-0
84Jinyang base /
85Xinyang base/
 Estrogen Steroids
86Megestrol AcetateCAS: 595-33-5
87LevonorgestrelCAS: 797-63-7 
88AltrenogestCAS: 850-52-2
89GestodeneCAS: 60282-87-3
90EthisteroneCAS: 434-03-7
91DrospirenoneCAS: 67392-87-4
92NorethindroneCAS: 68-22-4
93MifepristoneCAS: 84371-65-3
94ProgesteroneCAS: 57-83-0
 Peptide
95MGF/
96PEG MGF/
97CJC-1295 with DACCAS: 863288-34-0 
98CJC-1295 without DACCAS: 863288-34-0 
99PT-141/
100MT-1(Melanotan)CAS: 75921-69-6 
101MT-2CAS: 121062-08-6
102GHRP-2CAS: 158861-67-7
103GHRP-6CAS: 87616-84-0
104IpamorelinCAS: 170851-70-4
105HexarelinCAS: 140703-51-1
106SermorelinCAS: 86168-78-7
107OxytocinCAS: 50-56-6
108TB500CAS: 77591-33-4
109Pentadecapeptide BPCCAS: 137525-51-0
110HG hFragment 176-191CAS: 158861-67-7
111TriptorelinCAS: 57773-63-4
112TesamorelinCAS: 106612-94-6
113GonadorelinCAS: 71447-49-9
114DSIPCAS: 62568-57-4
115SelankCAS: 129954-34-3
116IG F-1Lr3CAS: 946870-92-4
 SARMS 
117YK11CAS: 431579-34-9
118MK-677(Ibutamoren)CAS: 159752-10-0
119MK-2866/OstarineCAS: 841205-47-8 
120Rad-140CAS: 1182367-47-0
121GW-501516/Cardarine/GSK-516CAS: 317318-70-0 
122SR9009CAS: 1379686-30-2
123LGD-4033CAS: 1165910-22-4  
124SunifiramCAS: 314728-85-3
125Andarine/S4/GTX-OO7CAS: 401900-40-1
126SR9011CAS: 1379686-29-9 
127Aicar/AcadesineCAS: 2627-69-2 
128LaxogeninCAS: 1177-71-5 
129Arimistane CAS: 1420-49-1
 Local Anesthetic Powder
130Benzocaine CAS: 94-09-7
131Benzocaine HCL CAS: 23239-88-5
132Bupivacaine HCL CAS: 14252-80-3
133Levobupivacaine HCL CAS: 27262-48-2
134Lidocaine CAS: 137-58-6
135Lidocaine HCLCAS: 73-78-9
136Pramoxine HCLCAS: 637-58-1
137Prilocaine CAS: 721-50-6
138Procaine CAS: 59-46-1
139Procaine HCL CAS: 51-05-8
140Propitocaine HCL CAS: 1786-81-8
141Ropivacaine HCL CAS: 132112-35-7
142Tetracaine CAS: 94-24-6
143Tetracaine HCL CAS: 136-47-0
 Weight Loss Powder
144OrlistatCAS: 96829-58-2
145RimonabantCAS: 168273-06-1
146L-carnitineCAS: 541-15-1
147Albuterol SulfateCAS: 51022-70-9
148Dextromethorphan hydrobromideCAS: 125-69-9
149Dextromethorphan hyd monohydrateCAS: 6700-34-1
150Synephrine hydrochlorideCAS: 5985-28-4
151TelmisartanCAS: 144701-48-4
152Lorcaserin HClCAS: 846589-98-8
153TheobromineCAS: 83-67-0
154DMAACAS: 13803-74-2
155DMBACAS: 71776-70-0
156Liothyronine sodium, T3 CAS: 55-06-1
157Levothyroxine Sodium , T4CAS: 25416-65-3
158Calcium Pyruvate CAS: 52009-14-0
159DNPCAS: 1011-73-0
 Nootropics Drug
160PiracetamCAS: 7491-74-9
161PramiracetamCAS: 68497-62-1
162AniracetamCAS: 72432-10-1
163ColuracetamCAS: 135463-81-9
164IdebenoneCAS: 58186-27-9
165Citicoline SodiumCAS: 33818-15-4
166NefiracetamCAS: 77191-36-7
167BisibutiamineCAS: 3286-46-2
168GABA CAS: 59-12-1
169PterostilbeneCAS: 537-42-8
170UbidecarenoneCAS: 303-98-0
171VinpocetineCAS: 42971-09-5
172OxiracetamCAS: 62613-82-5
173DMAECAS: 5988-51-2
174Picamilon Na+CAS: 62936-56-5
175Meclo fenoxate HClCAS: 3685-84-5
176SunifiramCAS: 314728-85-3
178Choline BitartrateCAS: 87-67-2
179Choline GlycerophosphateCAS: 28319-77-9
180ResveratrolCAS: 501-36-0
181PhenibutCAS: 1078-21-3
182MelatonineCAS: 73-31-4
Send your message to this supplier
Avatar
Miss Viki
*From:
To: Miss Viki
*Message:

Enter between 20 to 4,000 characters.

This is not what you are looking for? Post a Sourcing Request Now

Find Similar Products By Category