Gold Member Since 2016
Wuhan Chuangshu E-Commerce Co., Ltd.

Lyophilized Peptides Cjc-1295 Without Dac, Cjc-1295 Without Dac for Muscle Building, Cjc-1295 Without Dac for Bodybuilding manufacturer / supplier in China, offering High Purity Peptides Cjc-1295 Without Dac for Muscle Enhance, Bulking Cycle Steroids Powder Drostanolone Enanthate, 99% Good Quality Pharmaceutical Raw Material Fluvastatin Sodium Salt and so on.

(/ )

Supplier Homepage Product Peptides High Purity Peptides Cjc-1295 Without Dac for Muscle Enhance

High Purity Peptides Cjc-1295 Without Dac for Muscle Enhance

FOB Price: US $0.75-1 / vial
Min. Order: 10 vial
Min. Order FOB Price
10 vial US $0.75-1/ vial
Get Latest Price
Port: Hong Kong, Hong Kong
Production Capacity: 5000kg/Month
Payment Terms: T/T, Western Union, Money Gram, Bitcoin

Request a custom order and have something just for you!

Send Customized Request
Basic Info
  • Model NO.: CJC-1295 without DAC
  • Customized: Customized
  • Suitable for: Elderly, Adult
  • Purity: >99%
  • Shipping Ways: : UPS, TNT, EMS, DHL, FedEx, etc(Door-to-Door)
  • Delivery Time: 4-7 Working Days
  • Appearance: White Lyophilized Powder
  • Transport Package: as Your Request
  • Origin: China
  • Powder: Yes
  • Certification: ISO 9001, USP, BP
  • State: Solid
  • Assay: 99% Min.
  • Payment Ways: T/T, Western Union, Money Gram, Bitcoin
  • Shipping Time: Within 24 Hours After Payment
  • Trademark: Chuangshu
  • Specification: Qualified
  • HS Code: 4400341001
Product Description
Quick detail:
Cas No.863288-34-0
Chemical NameCJC-1295 without DAC
FormulaC152H252N44O42
One Letter SequenceY(d-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2
Three Letter SequenceH-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
Molecular Weight (MW)3367.97
Solubilityaqueous soluble
StorageStore at -20°C. Product is guaranteed 2 years from the date of shipment. Following reconstitution, store at -20°C. We recommend to add a carrier protein (0.1% HSA or BSA) for long term storage.


Description:
CJC-1295 without DAC is a synthetically modified form of growth hormone releasing hormone (GHRH) [1].
GHRH is used for the treatment of impaired growth in patients with intact pituitary function. The most limitation of its use is the short half-life of it. CJC-1295 was developed for solving this problem. It contains the therapeutic moiety of GHRH (GHRH-(1-29)NH2) with four amino acid substitutions. The change of structure made it more resistant to proteolytic cleavage than GHRH. A drug affinity complex (DAC) linked to the core therapeutic moiety allowed CJC-1295 to bind to endogenous albumin, thus extending its half-life and duration of action. The half-life of CJC-1295 is about 6 to 8 days after sc administration. It was reported that administration of CJC-1295 caused sustained elevations of mean serum GH and IGF-I levels. CJC-1295 also had stimulatory effects on somatotroph cell proliferation. Once-daily injections of CJC-1295 at dose of 2 μg were able to completely normalize growth 

FAQ:

Q1: Are you a manufacture?
A: We manufacture bulk products in our factory.We have lab, pilot workshop.

Q2: What certificates and documents do you offer?
A: Some technical paperwork is available, such as COA, HNMR, HPLC, LC-MS ect.

Q3 :Can I get a sample?
A: Of course. For most products we can provide you a free sample, while the shipping cost should undertake by your side.

Q4: Is there any discount?
A: Yes, for larger quantity, we always support with better price.

Q5: What is MOQ?
A: For steroid powder, the MOQ is 10grams.
   For semi-finished liquid, the MOQ is 50ml.

Q6: How long does it take to the goods arrived ?
A: It is Depending on your location,
For small order, please expect 5-7 days by DHL,UPS,TNT, FEDEX, EMS.
For mass order, please allow 5-8 days by Air, 20-35 days by Sea.

Q7: Do  you  have  any  reshipment  policy ?  
A: we have good after-sale service and re-shipment policy if the parcel  lose.

Q8: What payments do you support?
A: T/T, West union, Moneygram, Bitcoin

Q9: Why should I choose you?
A: Powerful technical support; Strict quality control; Professional and warm sales team; Excellent pre-sale and after-sale service.
Anything wrong happening in our products will be solved within 2 hours. We always offer relative technical support/consultant. Quick response. All your inquiry will be replied within 24 hours.


 
Send your message to this supplier
Avatar
Miss Mita
*From:
To: Miss Mita
*Message:

Enter between 20 to 4,000 characters.

This is not what you are looking for? Post a Sourcing Request Now

Find Similar Products By Category