Gold Member Since 2016
Wuhan Chuangshu E-Commerce Co., Ltd.

Lyophilized Peptides Cjc-1295 Without Dac, Cjc-1295 Without Dac for Muscle Building, Cjc-1295 Without Dac for Bodybuilding manufacturer / supplier in China, offering High Purity Peptides Cjc-1295 Without Dac for Muscle Enhance, High Quality Local Anesthetic Powder Bupivacaine HCl, CAS: 360-70-3 Nandrolone Decanoate and 98% Deca-Durabolin Injectable Liquid and so on.

(/ )

Supplier Homepage Product Peptides High Purity Peptides Cjc-1295 Without Dac for Muscle Enhance

High Purity Peptides Cjc-1295 Without Dac for Muscle Enhance

FOB Price: US $0.75-1 / vial
Min. Order: 10 vial
Min. Order FOB Price
10 vial US $0.75-1/ vial
Get Latest Price
Port: Hong Kong, Hong Kong
Production Capacity: 5000kg/Month
Payment Terms: T/T, Western Union, Money Gram, Bitcoin

Request a custom order and have something just for you!

Send Customized Request
Basic Info
  • Model NO.: CJC-1295 without DAC
  • Customized: Customized
  • Suitable for: Elderly, Adult
  • Purity: >99%
  • Shipping Ways: : UPS, TNT, EMS, DHL, FedEx, etc(Door-to-Door)
  • Delivery Time: 4-7 Working Days
  • Appearance: White Lyophilized Powder
  • Transport Package: as Your Request
  • Origin: China
  • Powder: Yes
  • Certification: ISO 9001, USP, BP
  • State: Solid
  • Assay: 99% Min.
  • Payment Ways: T/T, Western Union, Money Gram, Bitcoin
  • Shipping Time: Within 24 Hours After Payment
  • Trademark: Chuangshu
  • Specification: Qualified
  • HS Code: 4400341001
Product Description
Quick detail:
Cas No.863288-34-0
Chemical NameCJC-1295 without DAC
FormulaC152H252N44O42
One Letter SequenceY(d-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2
Three Letter SequenceH-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
Molecular Weight (MW)3367.97
Solubilityaqueous soluble
StorageStore at -20°C. Product is guaranteed 2 years from the date of shipment. Following reconstitution, store at -20°C. We recommend to add a carrier protein (0.1% HSA or BSA) for long term storage.


Description:
CJC-1295 without DAC is a synthetically modified form of growth hormone releasing hormone (GHRH) [1].
GHRH is used for the treatment of impaired growth in patients with intact pituitary function. The most limitation of its use is the short half-life of it. CJC-1295 was developed for solving this problem. It contains the therapeutic moiety of GHRH (GHRH-(1-29)NH2) with four amino acid substitutions. The change of structure made it more resistant to proteolytic cleavage than GHRH. A drug affinity complex (DAC) linked to the core therapeutic moiety allowed CJC-1295 to bind to endogenous albumin, thus extending its half-life and duration of action. The half-life of CJC-1295 is about 6 to 8 days after sc administration. It was reported that administration of CJC-1295 caused sustained elevations of mean serum GH and IGF-I levels. CJC-1295 also had stimulatory effects on somatotroph cell proliferation. Once-daily injections of CJC-1295 at dose of 2 μg were able to completely normalize growth 

Our competitive advantage:
1.Rich experience
We specialize in this field for many years,our steroids and hormones exported to Overseas, to Europe,Africa,Asia, Americas and other country, and we have got very good feedback from our customers,and Established long friendly relations of cooperation.
2.Great quality, purity and favourable
Good quality is one of our secret success, welcome order the samples, MOQ just 10 grams.
3.Safest and fastest delivery
a.We have Adequate stock,and can arranged within 24hours when receive the payment.Tracking number would be informed quickly after shipment.
b.We have special way could ship 0.01 kilo to 5000,000 kilo products a time. We offer melting powder into liquid service
4.Good after-sales service
24/7 is available, tell the package update asap, and will try best solve when customer encountered various problems!


More products:
Testosterone enanthateCAS: 315-37-7
Testosterone acetateCAS: 1045-69-8
Testosterone propionateCAS: 57-85-2
Testosterone cypionateCAS: 58-20-8
Testosterone phenylpropionateCAS: 1255-49-8
AnavarCAS: 53-39-4
DianabolCAS: 72-63-9
WinstrolCAS: 10418-03-8
AnadrolCAS: 434-07-1
Testosterone isocaproateCAS: 15262-86-9
Testosterone decanoateCAS: 5721-91-5
Exemestane AcatateCAS: 107868-30-4
Testosterone Sustanon 250--
Testosterone undecanoateCAS: 5949-44-0
Turinabol (4-Chlorodehydromethyltestosterone)CAS: 855-19-6
Accutane (Isotretinoin)CAS: 4759-48-2
DutasterideCAS: 164656-23-9
Stanolone powderCAS: 521-18-6
Nandrolone decanoateCAS: 360-70-3
Nandrolone cypionateCAS: 601-63-8
Nandrolone phenypropionate /DurabolinCAS: 62-90-8
Boldenone undecylenate (Equipoise)CAS: 13103-34-9
Boldenone acetateCAS :2363-59-9
Drostanolone propionate/MasteronCAS: 521-12-0
Drostanolone enanthateCAS: 472-61-1
Trenbolone acetateCAS: 10161-34-9
Trenbolone EnanthateCAS: 10161-33-8
Trenbolone Hexahydrobenzyl CarbonateCAS: 23454-33-3
Vardenafil powderCAS: 224785-90-4
Methenolone Enanthate (Primobolan)CAS: 303-42-4
Methenolone AcetateCAS: 434-05-9
Methandrostenolone/DianabolCAS: 72-63-9
Tamoxifen Citrate /NolvadexCAS: 54965-24-1
Clomiphene citrateCAS: 50-41-9
Toremifene citrateCAS: 89778-27-8
Letrazole/FemaraCAS: 112809-51-5
vardenafilCAS: 831217-01-7
Send your message to this supplier
Avatar
Miss Viki
*From:
To: Miss Viki
*Message:

Enter between 20 to 4,000 characters.

This is not what you are looking for? Post a Sourcing Request Now

Find Similar Products By Category